PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang03g09140.1
Common NameLR48_Vigan09g168000
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family GRAS
Protein Properties Length: 586aa    MW: 66088.6 Da    PI: 5.3015
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang03g09140.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS316.17.5e-972125832374
            GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlar.svselykal.ppsetsekn.sseelaalklfsevsPilkf 93 
                      e Ll+cAe v ++++e+a++lL++ + l+s++g+p++R+++yf+eAL +r+   ++   +k l + ++ ++++  +e   a ++f+e+ P+ ++
  Vang03g09140.1 212 SESLLACAEKVGHQQFERARKLLSHCQSLSSKTGSPVKRIVHYFAEALLHRIDTeTGRASSKDLhKGQSFDPEEaAKELNPAITAFYEALPFCQI 306
                     578*************************************************995556666667444555555535555667788********** PP

            GRAS  94 shltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegpp.slRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrle 187
                     s +ta qaI e +++++++H+iD++i +G+QW+ L+qaL sR + p   l+iT+++s +   ++ +e tg+rL++fA+ l++pf+fn++++ +l 
  Vang03g09140.1 307 SVFTAVQAIIEDIAEAKKIHVIDLEIRKGGQWAILMQALESRHQCPVeLLKITAIESGT--TRHIVEDTGKRLKDFAQGLNIPFSFNIVMVPDLL 399
                     *******************************************6665499*******44..9999***********************9999*** PP

            GRAS 188 dleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseer 282
                      l+ + ++++pgEa+aV ++++l    ++s +le     +++++++l+P+v+vv+e ea+hns+sF++rf+eal ++sa+fd+lea +  ++++r
  Vang03g09140.1 400 HLKEDLFEIDPGEAIAVYSQFALRAKIQQSDQLEI----IMRVIRTLNPNVMVVSEIEANHNSTSFVNRFIEALFFFSAFFDCLEACMKGNEKTR 490
                     ***************************99999999....******************************************************** PP

            GRAS 283 ikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                     + +E  +++  i+n+va+egaer+ r+ +   Wr+ ++++G+ + +ls+    qa+l+ ++++ +   + +++ ++l+ gWk+ p+ svS+W+
  Vang03g09140.1 491 MIIESLYFSHGIKNIVATEGAERKTRNVKIDVWRAFFSRFGMVEKELSTLSLYQADLVSKRFPcGSSCTFDKNGQCLIVGWKGTPINSVSVWK 583
                     ***************************************************************999999***********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098546.594185562IPR005202Transcription factor GRAS
PfamPF035142.6E-94212583IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 586 aa     Download sequence    Send to blast
MEDLYHVCFS TVDENSSSSN DIFWGSEEHN EIKKLHFSGA ENHGVYGGVD SFYSNFEFST  60
DYPSGYLISS NQEKYHQQQS YHDYGDLDDN LQFDMVSPPL QFDAQYPTSG TTEDKPHSTF  120
PLASLEILKN YGKGFKRFSY EGKSLQPVVD SVATDEFGFR KLSTEDIMRI AGTRFIKSSS  180
SESEPLTFLE THPYGFSFSG FSDEEKEDVA LSESLLACAE KVGHQQFERA RKLLSHCQSL  240
SSKTGSPVKR IVHYFAEALL HRIDTETGRA SSKDLHKGQS FDPEEAAKEL NPAITAFYEA  300
LPFCQISVFT AVQAIIEDIA EAKKIHVIDL EIRKGGQWAI LMQALESRHQ CPVELLKITA  360
IESGTTRHIV EDTGKRLKDF AQGLNIPFSF NIVMVPDLLH LKEDLFEIDP GEAIAVYSQF  420
ALRAKIQQSD QLEIIMRVIR TLNPNVMVVS EIEANHNSTS FVNRFIEALF FFSAFFDCLE  480
ACMKGNEKTR MIIESLYFSH GIKNIVATEG AERKTRNVKI DVWRAFFSRF GMVEKELSTL  540
SLYQADLVSK RFPCGSSCTF DKNGQCLIVG WKGTPINSVS VWKFI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-412135836375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150380.0AP015038.1 Vigna angularis var. angularis DNA, chromosome 5, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014491526.10.0PREDICTED: DELLA protein RGL1-like
TrEMBLA0A0L9VD870.0A0A0L9VD87_PHAAN; Uncharacterized protein
TrEMBLA0A0S3S4N30.0A0A0S3S4N3_PHAAN; Uncharacterized protein
STRINGGLYMA09G04110.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF47933162
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66350.13e-45RGA-like 1
Publications ? help Back to Top
  1. Yang K, et al.
    Genome sequencing of adzuki bean (Vigna angularis) provides insight into high starch and low fat accumulation and domestication.
    Proc. Natl. Acad. Sci. U.S.A., 2015. 112(43): p. 13213-8
    [PMID:26460024]